(data stored in ACNUC7421 zone)

EMBL: CP000859.PE124

CP000859.PE124       Location/Qualifiers
FT   CDS             complement(139017..139463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0124"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: drm:Dred_0308
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65934"
FT                   /db_xref="GOA:A8ZSM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM1"
FT                   /protein_id="ABW65934.1"
FT                   /translation="MYKTNMKVNNKNFLYKLSCIRKSAFSFLEGEMARVGVTDIPPSYG
FT                   DILYAIYHQKTGYVKEIVGQSHKDKSTVSSIINQLEKKGYVEKFSDPEDGRRVKVRLTK
FT                   QAEQQITVVSEISLKLQDKLFKNMSDEEQEILFLMLNKIEKNLK"
     MYKTNMKVNN KNFLYKLSCI RKSAFSFLEG EMARVGVTDI PPSYGDILYA IYHQKTGYVK        60
     EIVGQSHKDK STVSSIINQL EKKGYVEKFS DPEDGRRVKV RLTKQAEQQI TVVSEISLKL       120
     QDKLFKNMSD EEQEILFLML NKIEKNLK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page