(data stored in ACNUC7421 zone)

EMBL: CP000859.PE125

CP000859.PE125       Location/Qualifiers
FT   CDS             139717..140736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0125"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343;
FT                   Methyltransferase type 11; KEGG: pca:Pcar_2700 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65935"
FT                   /db_xref="GOA:A8ZSM2"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM2"
FT                   /protein_id="ABW65935.1"
FT                   /translation="MPRDLRRFELELFTLPSQIDFLREHQPLKSILTELLICPVCLPGE
FT                   HGLKLKSDETVADDIIRGDLTCDCCGRSFPIRDGLADLDPGREARSRTASKYETPLVLS
FT                   SYLWSHFAGILKDSQASGAYVEWAGLMASHDGLALDVGSAVGRFAFEMAQKCDFVIGLD
FT                   NSVTFIRTARELMQQRRKRLCLPDEGHLTLDMDLVLPETWRTSNMEFIVADAQALPFRC
FT                   NQFASVASLNMVDKLPRPLAHLQESNRVAKDHDARFLLSDPFSWSGEVAAEENWLGGLG
FT                   KGPFAGHGLENTMTLLADEKGLLGPRWTIEQQGHVWWKIRTHSNHFELIRSRYVKAVR"
     MPRDLRRFEL ELFTLPSQID FLREHQPLKS ILTELLICPV CLPGEHGLKL KSDETVADDI        60
     IRGDLTCDCC GRSFPIRDGL ADLDPGREAR SRTASKYETP LVLSSYLWSH FAGILKDSQA       120
     SGAYVEWAGL MASHDGLALD VGSAVGRFAF EMAQKCDFVI GLDNSVTFIR TARELMQQRR       180
     KRLCLPDEGH LTLDMDLVLP ETWRTSNMEF IVADAQALPF RCNQFASVAS LNMVDKLPRP       240
     LAHLQESNRV AKDHDARFLL SDPFSWSGEV AAEENWLGGL GKGPFAGHGL ENTMTLLADE       300
     KGLLGPRWTI EQQGHVWWKI RTHSNHFELI RSRYVKAVR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page