(data stored in ACNUC7421 zone)

EMBL: CP000859.PE127

CP000859.PE127       Location/Qualifiers
FT   CDS             143290..143562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_3623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65937"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM4"
FT                   /protein_id="ABW65937.1"
FT                   /translation="MNISDVRPGESAINVFFSEDTLSVDLNDGRTITVPLAWFPRLLHA
FT                   TPGQRENWKICGGGFGIHWPDIDEDLSTAGLLRGAPAPKALSNVA"
     MNISDVRPGE SAINVFFSED TLSVDLNDGR TITVPLAWFP RLLHATPGQR ENWKICGGGF        60
     GIHWPDIDED LSTAGLLRGA PAPKALSNVA                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page