(data stored in ACNUC7421 zone)

EMBL: CP000859.PE130

CP000859.PE130       Location/Qualifiers
FT   CDS             145259..145945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0130"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: ppd:Ppro_2005 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65940"
FT                   /db_xref="GOA:A8ZSM7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM7"
FT                   /protein_id="ABW65940.1"
FT                   /translation="MFDTPSVSYAVAFGAGLLSFFTPCVLPLIPVYFTLITGLSLENLT
FT                   QAPDAEVRARVIFSTIAYVLGFSAVFILLGASAFFLGSLINQHLGVLRVIGGVVIVVLG
FT                   IHMTGVITIPGLQSEKRVHVRQRSMSLAGAFLVGALFAAGWTPCIGPILGSILIVAGSQ
FT                   ETALRGMLLLSAYSAGLALPFLLLSFFINALISFIRRASRVIKYINIVAGVLLIGIGIV
FT                   LIAGLW"
     MFDTPSVSYA VAFGAGLLSF FTPCVLPLIP VYFTLITGLS LENLTQAPDA EVRARVIFST        60
     IAYVLGFSAV FILLGASAFF LGSLINQHLG VLRVIGGVVI VVLGIHMTGV ITIPGLQSEK       120
     RVHVRQRSMS LAGAFLVGAL FAAGWTPCIG PILGSILIVA GSQETALRGM LLLSAYSAGL       180
     ALPFLLLSFF INALISFIRR ASRVIKYINI VAGVLLIGIG IVLIAGLW                    228
//

If you have problems or comments...

PBIL Back to PBIL home page