(data stored in ACNUC7421 zone)

EMBL: CP000859.PE133

CP000859.PE133       Location/Qualifiers
FT   CDS             complement(147111..147398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65943"
FT                   /db_xref="GOA:A8ZSN0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN0"
FT                   /protein_id="ABW65943.1"
FT                   /translation="MRRTSLLADQEPVISWHDTTAVYGIAAGFALAVMLFAGAGISVAG
FT                   EKAEFSHYVWVAWLLLVLGAVVLMASMLRLGRRLFLAIERYRDKGPGLPL"
     MRRTSLLADQ EPVISWHDTT AVYGIAAGFA LAVMLFAGAG ISVAGEKAEF SHYVWVAWLL        60
     LVLGAVVLMA SMLRLGRRLF LAIERYRDKG PGLPL                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page