(data stored in ACNUC7421 zone)

EMBL: CP000859.PE136

CP000859.PE136       Location/Qualifiers
FT   CDS             150159..150455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD0736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65946"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN3"
FT                   /protein_id="ABW65946.1"
FT                   /translation="MSHHHDSHDHSHGHDHGHHHDHHHTHAGGGEMSTKEKLVKLFDYW
FT                   LRHNESHGDTYTQWIDQAEQEGLSDTAAILKEIADLTRQITAKFQAGAATLKK"
     MSHHHDSHDH SHGHDHGHHH DHHHTHAGGG EMSTKEKLVK LFDYWLRHNE SHGDTYTQWI        60
     DQAEQEGLSD TAAILKEIAD LTRQITAKFQ AGAATLKK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page