(data stored in ACNUC7421 zone)

EMBL: CP000859.PE140

CP000859.PE140       Location/Qualifiers
FT   CDS             153335..154450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0140"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: aba:Acid345_2946 response regulator
FT                   receiver modulated serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65950"
FT                   /db_xref="GOA:A8ZSN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN7"
FT                   /protein_id="ABW65950.1"
FT                   /translation="MQQLFTILVVDDNLLNLKLLSTTLENHGYKTITAVDGPTARQLAQ
FT                   TEKPDIILLDVKMPGEDGFEVIRQLKNDPATGGIPVLFLSGVIELESKLTGFELGAVDY
FT                   ITKPFHPLEVLARVRLHLKLSIATSSLISNQADKLRQITEAQTAMLTTPDNQPGAGFGV
FT                   YYCALEEAGGDFYDVLPISDDIYGYFVADFSGHDIKTSYLISSVKALLKQNCTPIYRPS
FT                   ESMKLINDVLVKILPEDKFLTSCYACLNRKTKNLTIISAGHPPVVYLPAKGEPSFIHLQ
FT                   GDVMGSFEDVSFGREAMKVKPGDRFYIYSDGLIESVQQKISWPEGSEKLLAACAAVADQ
FT                   PITSAPQRIAEKLKPESVAIEDDVIVLGIQV"
     MQQLFTILVV DDNLLNLKLL STTLENHGYK TITAVDGPTA RQLAQTEKPD IILLDVKMPG        60
     EDGFEVIRQL KNDPATGGIP VLFLSGVIEL ESKLTGFELG AVDYITKPFH PLEVLARVRL       120
     HLKLSIATSS LISNQADKLR QITEAQTAML TTPDNQPGAG FGVYYCALEE AGGDFYDVLP       180
     ISDDIYGYFV ADFSGHDIKT SYLISSVKAL LKQNCTPIYR PSESMKLIND VLVKILPEDK       240
     FLTSCYACLN RKTKNLTIIS AGHPPVVYLP AKGEPSFIHL QGDVMGSFED VSFGREAMKV       300
     KPGDRFYIYS DGLIESVQQK ISWPEGSEKL LAACAAVADQ PITSAPQRIA EKLKPESVAI       360
     EDDVIVLGIQ V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page