(data stored in ACNUC7421 zone)

EMBL: CP000859.PE142

CP000859.PE142       Location/Qualifiers
FT   CDS             155249..156262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0142"
FT                   /product="Protein of unknown function DUF933"
FT                   /note="PFAM: Protein of unknown function DUF933; KEGG:
FT                   sfu:Sfum_4023 protein of unknown function DUF933"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65952"
FT                   /db_xref="GOA:A8ZSN9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN9"
FT                   /protein_id="ABW65952.1"
FT                   /translation="MKLGLIGKPGAGKKTLFEALTKSDPDSGHKGDLRIAAIYVPDPRV
FT                   DVLSAMYSPRKTIYAQIEYCLGRTAGDKDLQLKAVADCDALIQVVRNFPVPGMPDPSPY
FT                   KDIAAMDEDLMLSDFVVIEKRLERIAADAKRGKKADAQEMALLDQVKQMIENGTPVRTQ
FT                   PEIATAPLLRGFSLLSAKPVLVLINNDEDDTALPAGPPPGGIDLMVVRGKLEHEISRMS
FT                   DDEAAEFLKEFGIDEPAIHRALRRSYAMLGLISFFTVGEDEVRAWTIKKGALAPEAAGT
FT                   IHSDMQKGFIRAEVVAYDALMAAGSYAEARKQGTVRLEGKTYEMADGDIVNIRFNV"
     MKLGLIGKPG AGKKTLFEAL TKSDPDSGHK GDLRIAAIYV PDPRVDVLSA MYSPRKTIYA        60
     QIEYCLGRTA GDKDLQLKAV ADCDALIQVV RNFPVPGMPD PSPYKDIAAM DEDLMLSDFV       120
     VIEKRLERIA ADAKRGKKAD AQEMALLDQV KQMIENGTPV RTQPEIATAP LLRGFSLLSA       180
     KPVLVLINND EDDTALPAGP PPGGIDLMVV RGKLEHEISR MSDDEAAEFL KEFGIDEPAI       240
     HRALRRSYAM LGLISFFTVG EDEVRAWTIK KGALAPEAAG TIHSDMQKGF IRAEVVAYDA       300
     LMAAGSYAEA RKQGTVRLEG KTYEMADGDI VNIRFNV                                337
//

If you have problems or comments...

PBIL Back to PBIL home page