(data stored in ACNUC7421 zone)

EMBL: CP000859.PE145

CP000859.PE145       Location/Qualifiers
FT   CDS             complement(159138..159731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65955"
FT                   /db_xref="GOA:A8ZSP2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP2"
FT                   /protein_id="ABW65955.1"
FT                   /translation="MMIAWINFFSLIFVSLIFMVLYVRSVSPAAQEKIIGPGAYRRCYH
FT                   LRVAASVAELLVVACFAIYCFFPLPTPLPDRFPWPWWFSVVVAGIIGVPALALMLIGLR
FT                   DAGEEALRPKKEQALFKGIYRRLRHPQAAGEVWLFPVIAILLHSPFLALFSLVFFPIFL
FT                   VLCYAEEQDLLLRHGETYAEYCRNTGAFWPRRHR"
     MMIAWINFFS LIFVSLIFMV LYVRSVSPAA QEKIIGPGAY RRCYHLRVAA SVAELLVVAC        60
     FAIYCFFPLP TPLPDRFPWP WWFSVVVAGI IGVPALALML IGLRDAGEEA LRPKKEQALF       120
     KGIYRRLRHP QAAGEVWLFP VIAILLHSPF LALFSLVFFP IFLVLCYAEE QDLLLRHGET       180
     YAEYCRNTGA FWPRRHR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page