(data stored in ACNUC7421 zone)

EMBL: CP000859.PE146

CP000859.PE146       Location/Qualifiers
FT   CDS             complement(159793..160650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65956"
FT                   /db_xref="GOA:A8ZSP3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP3"
FT                   /protein_id="ABW65956.1"
FT                   /translation="MQEFNLDKKFKRLMKGCLVVFVAFLFLGLALPFFPGDGKGSTEGA
FT                   LILSIICTIVFGFFTILIWRTLKKLPCVDIIVDNDGLWYKHKQKKDGLVPWKKIGKIKE
FT                   RLYLQCLDILDSDGRKLIRIEYQLNNFEVLRNILNDKLSDWLPKSQQSSFSKNVLYHFF
FT                   YGACIIGFSWLGLYVGRHSNPWFGYIGMGILVIIILYEYLATAYRLDLIDNGLLIVYPT
FT                   SKKTIAYSDISSIKMADTFQKGARFPEVWVTVKNGSKPYKLKQLGVDANSLFITLKKAK
FT                   ELKA"
     MQEFNLDKKF KRLMKGCLVV FVAFLFLGLA LPFFPGDGKG STEGALILSI ICTIVFGFFT        60
     ILIWRTLKKL PCVDIIVDND GLWYKHKQKK DGLVPWKKIG KIKERLYLQC LDILDSDGRK       120
     LIRIEYQLNN FEVLRNILND KLSDWLPKSQ QSSFSKNVLY HFFYGACIIG FSWLGLYVGR       180
     HSNPWFGYIG MGILVIIILY EYLATAYRLD LIDNGLLIVY PTSKKTIAYS DISSIKMADT       240
     FQKGARFPEV WVTVKNGSKP YKLKQLGVDA NSLFITLKKA KELKA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page