(data stored in ACNUC7421 zone)

EMBL: CP000859.PE149

CP000859.PE149       Location/Qualifiers
FT   CDS             complement(162933..164750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0149"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation; KEGG:
FT                   gsu:GSU2001 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65959"
FT                   /db_xref="GOA:A8ZSP6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP6"
FT                   /protein_id="ABW65959.1"
FT                   /translation="MAVIRILPEHLSNKIAAGEVVERPASVVKELVENAIDAGASAIFV
FT                   EIQNGGRSLVRVTDNGAGMGKDDALLCLERYATSKIADEKSLFAISTLGFRGEAIPSIA
FT                   SVSEFVLTTRPADADAGTRIRVSGGTITDVADTGAPPGTTVEVGRLFFNTPARRKFLKA
FT                   VATETGHIADTLAAFALCRPDIHFKLVQDGRTVKNWPRTADPLERITDVLGSQTRGHMA
FT                   PISCADDTVTISGWTSSPAVTRSTSQKIHLFVNGRIVKDRGLQYALFEGYRGRLVKGAF
FT                   PVAAIFINIPFDRVDVNVHPTKNEVRFADQRRVYQALKTAVAGAWAINAAPPWSDGQKP
FT                   SRPAPAFSLPGVRPAPKVSESVFQYATPLPLPSFANAGDEPPAPARPRLSGDAEPRPLE
FT                   TPVSSDGHQSFFRFSDLAVVGQVFNTYIVCQADAQVVLIDQHAAHERILFEALKQRGQN
FT                   RPLPGQNLLVPETVELTHKSAAAIEPLLDAFAAMGLEIEPFGPTAFVIKAVPAVLADTA
FT                   VGPMVAEIAEKQADTGFAPDPDTLTNDVLHVMACHAAIRAHQRLSEAEIKALLARLDGC
FT                   DNPRHCPHGRPTAIFWSTSEIEKAFKRIV"
     MAVIRILPEH LSNKIAAGEV VERPASVVKE LVENAIDAGA SAIFVEIQNG GRSLVRVTDN        60
     GAGMGKDDAL LCLERYATSK IADEKSLFAI STLGFRGEAI PSIASVSEFV LTTRPADADA       120
     GTRIRVSGGT ITDVADTGAP PGTTVEVGRL FFNTPARRKF LKAVATETGH IADTLAAFAL       180
     CRPDIHFKLV QDGRTVKNWP RTADPLERIT DVLGSQTRGH MAPISCADDT VTISGWTSSP       240
     AVTRSTSQKI HLFVNGRIVK DRGLQYALFE GYRGRLVKGA FPVAAIFINI PFDRVDVNVH       300
     PTKNEVRFAD QRRVYQALKT AVAGAWAINA APPWSDGQKP SRPAPAFSLP GVRPAPKVSE       360
     SVFQYATPLP LPSFANAGDE PPAPARPRLS GDAEPRPLET PVSSDGHQSF FRFSDLAVVG       420
     QVFNTYIVCQ ADAQVVLIDQ HAAHERILFE ALKQRGQNRP LPGQNLLVPE TVELTHKSAA       480
     AIEPLLDAFA AMGLEIEPFG PTAFVIKAVP AVLADTAVGP MVAEIAEKQA DTGFAPDPDT       540
     LTNDVLHVMA CHAAIRAHQR LSEAEIKALL ARLDGCDNPR HCPHGRPTAI FWSTSEIEKA       600
     FKRIV                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page