(data stored in ACNUC7421 zone)

EMBL: CP000859.PE151

CP000859.PE151       Location/Qualifiers
FT   CDS             complement(165014..166474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0151"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: sat:SYN_00308 aspartyl/glutamyl-tRNA(asn/Gln)
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65961"
FT                   /db_xref="GOA:A8ZSP8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZSP8"
FT                   /protein_id="ABW65961.1"
FT                   /translation="MEPYALTIHEARQLLDKKEISSVELTRSVFDRIERVEPKVGAYIT
FT                   LARESALSAAAAADTRLQSGGIAPLTGIPLAVKDLICTTGLRTTCASRMLETFMPPYDA
FT                   TVIEKLKTQGAVITGKVNMDEFAMGSSTEHSALGSTKNPWNLACIPGGSSGGSAASVAA
FT                   DMCLGSLGSDTGGSIRQPASHCGVVGIKPTYGRVSRYGLVAFASSLDQIGVLAKDVTDS
FT                   ALLLSAISGHDPSDSTSVPREVPDYAASCEKGLSGLTIGVCREYINAEGLDPEVADTVN
FT                   RSIEHMKAQGAACVEVSLPHAQYAVAAYYVIAPAEASSNLARYDGVKYGFRDPEADSLL
FT                   EMYARTRSRGFGKEVQRRIIIGTYCLSSGYYDAYYRKASQVRSLIADDFKKAFETCDVI
FT                   VSPVAPTPAFELGAKTEDPLTMYLSDIFTLSANLAGVPGMSVPGGFSSTGLPIGVQLIA
FT                   GHFNEPALVRCAWNLEQAVNIANKKPAL"
     MEPYALTIHE ARQLLDKKEI SSVELTRSVF DRIERVEPKV GAYITLARES ALSAAAAADT        60
     RLQSGGIAPL TGIPLAVKDL ICTTGLRTTC ASRMLETFMP PYDATVIEKL KTQGAVITGK       120
     VNMDEFAMGS STEHSALGST KNPWNLACIP GGSSGGSAAS VAADMCLGSL GSDTGGSIRQ       180
     PASHCGVVGI KPTYGRVSRY GLVAFASSLD QIGVLAKDVT DSALLLSAIS GHDPSDSTSV       240
     PREVPDYAAS CEKGLSGLTI GVCREYINAE GLDPEVADTV NRSIEHMKAQ GAACVEVSLP       300
     HAQYAVAAYY VIAPAEASSN LARYDGVKYG FRDPEADSLL EMYARTRSRG FGKEVQRRII       360
     IGTYCLSSGY YDAYYRKASQ VRSLIADDFK KAFETCDVIV SPVAPTPAFE LGAKTEDPLT       420
     MYLSDIFTLS ANLAGVPGMS VPGGFSSTGL PIGVQLIAGH FNEPALVRCA WNLEQAVNIA       480
     NKKPAL                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page