(data stored in ACNUC7421 zone)

EMBL: CP000859.PE153

CP000859.PE153       Location/Qualifiers
FT   CDS             166953..168641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH217 ABC-2 type transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65963"
FT                   /db_xref="GOA:A8ZSQ0"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ0"
FT                   /protein_id="ABW65963.1"
FT                   /translation="MLKTIKTLLAPRILSFKNRIFLSGKTRVAVFGAVGLVLWAGVFAG
FT                   AFRVLTYFESIEDLGDILANKLLSMLFVVMLSLLVFSSIITTLSKLYLSRDLDLVHSLP
FT                   VAARHLFFARWIESTADSSWMVVLFVLPVFLAHGIVYSAGPLFYLAVVLFLLMLCVTSS
FT                   AISATGIAFVVNLISASRLKTIFVFLGLLLFVLLYVAFRMMRPERLVDPEMFATTLVYL
FT                   RSLNAPAPAWLPSTWAYDGVTAALSGNTGALLFNLLLSGACAGSLVVFMLIVAEAVYFS
FT                   GFSRSSSGWADPVTPEDTARRIYRDRSWPAFLPAPARAFFVKEVRTFVRDQSQWSQLFL
FT                   IAALVVIYIYNFKVLPLETSPMPVVWVQNIFAFLNMGLAAFVLTAVTARFAFPAVSMEK
FT                   SAFWIVQCAPVSIRTFLRIKFFVYLVPLFVLTMTLIVVTNLLLNVAGEMMVLSLVTVSL
FT                   MVPAIVAMGVGIGAVYPDFSSENPAQAVSSFGGFVFMATSALYVIAVIVLEAGPASRLV
FT                   FAGLRGRSLSPESWAWIIGSFTTVVALSVLAVVVPLRLGERRLQG"
     MLKTIKTLLA PRILSFKNRI FLSGKTRVAV FGAVGLVLWA GVFAGAFRVL TYFESIEDLG        60
     DILANKLLSM LFVVMLSLLV FSSIITTLSK LYLSRDLDLV HSLPVAARHL FFARWIESTA       120
     DSSWMVVLFV LPVFLAHGIV YSAGPLFYLA VVLFLLMLCV TSSAISATGI AFVVNLISAS       180
     RLKTIFVFLG LLLFVLLYVA FRMMRPERLV DPEMFATTLV YLRSLNAPAP AWLPSTWAYD       240
     GVTAALSGNT GALLFNLLLS GACAGSLVVF MLIVAEAVYF SGFSRSSSGW ADPVTPEDTA       300
     RRIYRDRSWP AFLPAPARAF FVKEVRTFVR DQSQWSQLFL IAALVVIYIY NFKVLPLETS       360
     PMPVVWVQNI FAFLNMGLAA FVLTAVTARF AFPAVSMEKS AFWIVQCAPV SIRTFLRIKF       420
     FVYLVPLFVL TMTLIVVTNL LLNVAGEMMV LSLVTVSLMV PAIVAMGVGI GAVYPDFSSE       480
     NPAQAVSSFG GFVFMATSAL YVIAVIVLEA GPASRLVFAG LRGRSLSPES WAWIIGSFTT       540
     VVALSVLAVV VPLRLGERRL QG                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page