(data stored in ACNUC7421 zone)

EMBL: CP000859.PE155

CP000859.PE155       Location/Qualifiers
FT   CDS             169729..172134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0155"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   chy:CHY_1609 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA
FT                   hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65965"
FT                   /db_xref="GOA:A8ZSQ2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ2"
FT                   /protein_id="ABW65965.1"
FT                   /translation="MSRKIKKAAVIGSGVMGGGIAALLASAGVETLLLDIVPFDLTDEQ
FT                   KKDPAARNRIVKFGYDTIMMSRPAALMHSSDAALISIGNLEDDFDKLADCDWIVEVVVE
FT                   NLKIKQQLFKRIEPVRKKGSIISSNTSGIPLKAMSEGLSSDFKQHFLGTHFFNPVRYMH
FT                   LLEIIKGEETSEEVLRFMAAFGEKRLGKGIVWAKDTPNFIGNRIGVQGIVKAMQLMLEM
FT                   GLTISEADALFGPVMGRPKTAMFKTTDLVGLDTMSHVAKNTYDLVTDDEARDDFLTPDF
FT                   VSTMIEKKLLGNKTKAGFYKTDRSPEGKKLRLVINPATLEYESAGDVDFPCIADAKSKK
FT                   TLPEKMKAIVYGEDKGAAYAWKVVASGLIYAANRVPEISDTIVEIDNAMKWGYNFEMGP
FT                   FETWDAIGVAESVAKMEKDGLAVPEKVKKMLADGNQTFYKIEKGQTLFYDFASGSYKAV
FT                   PVSDVAVSLAILKGEGREVKSCKSASLIDLGDGVFCCEFHTKMNALNTELIAFMHEAMD
FT                   YVDANGAGMVLGNQAGGMPGAFSAGADLKEILTAVGNKEFDGIDTMIDSLQQAVQRERY
FT                   SHFPVVAAPYGMALGGGCEVCLGADRIVAHAELYMGLVEIGVGVLPAGTGCMNLWKKMT
FT                   SGIPAPVTDADLAKFFIPTFMAIAMAKVSMSAAEARANGFLGPNDRIVFNRDNLIGEAK
FT                   KEVLRMIDDGYAPPAKKPLKVLGEAAWGMVNAEIFNMQNGGYVSEYDAYLAKNIAYVIA
FT                   GGDARTNSELDEQAILNLERSMFIEFLKQEKTMARIEHMLKTGKPLRN"
     MSRKIKKAAV IGSGVMGGGI AALLASAGVE TLLLDIVPFD LTDEQKKDPA ARNRIVKFGY        60
     DTIMMSRPAA LMHSSDAALI SIGNLEDDFD KLADCDWIVE VVVENLKIKQ QLFKRIEPVR       120
     KKGSIISSNT SGIPLKAMSE GLSSDFKQHF LGTHFFNPVR YMHLLEIIKG EETSEEVLRF       180
     MAAFGEKRLG KGIVWAKDTP NFIGNRIGVQ GIVKAMQLML EMGLTISEAD ALFGPVMGRP       240
     KTAMFKTTDL VGLDTMSHVA KNTYDLVTDD EARDDFLTPD FVSTMIEKKL LGNKTKAGFY       300
     KTDRSPEGKK LRLVINPATL EYESAGDVDF PCIADAKSKK TLPEKMKAIV YGEDKGAAYA       360
     WKVVASGLIY AANRVPEISD TIVEIDNAMK WGYNFEMGPF ETWDAIGVAE SVAKMEKDGL       420
     AVPEKVKKML ADGNQTFYKI EKGQTLFYDF ASGSYKAVPV SDVAVSLAIL KGEGREVKSC       480
     KSASLIDLGD GVFCCEFHTK MNALNTELIA FMHEAMDYVD ANGAGMVLGN QAGGMPGAFS       540
     AGADLKEILT AVGNKEFDGI DTMIDSLQQA VQRERYSHFP VVAAPYGMAL GGGCEVCLGA       600
     DRIVAHAELY MGLVEIGVGV LPAGTGCMNL WKKMTSGIPA PVTDADLAKF FIPTFMAIAM       660
     AKVSMSAAEA RANGFLGPND RIVFNRDNLI GEAKKEVLRM IDDGYAPPAK KPLKVLGEAA       720
     WGMVNAEIFN MQNGGYVSEY DAYLAKNIAY VIAGGDARTN SELDEQAILN LERSMFIEFL       780
     KQEKTMARIE HMLKTGKPLR N                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page