(data stored in ACNUC7421 zone)

EMBL: CP000859.PE16

CP000859.PE16        Location/Qualifiers
FT   CDS             complement(17995..18588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65826"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ9"
FT                   /protein_id="ABW65826.1"
FT                   /translation="MKTVRLIVCLGLAVLMTGFWGCGRSEIDFGSFSGNVYKNDYFDMA
FT                   LTLADDVRIDTRQKAAAAQAAKPSELQTLTLFTAYLYPDDSEVLFNANLMAMADRIDKP
FT                   MGVKTGRDYHLYTKKLLESTPIPVSLSQDITTQTLGGKTFDLMQAAIPLAQVSVKQDLY
FT                   AAAMGDYILVLAISYTNPDERAALLEMLNTVSFK"
     MKTVRLIVCL GLAVLMTGFW GCGRSEIDFG SFSGNVYKND YFDMALTLAD DVRIDTRQKA        60
     AAAQAAKPSE LQTLTLFTAY LYPDDSEVLF NANLMAMADR IDKPMGVKTG RDYHLYTKKL       120
     LESTPIPVSL SQDITTQTLG GKTFDLMQAA IPLAQVSVKQ DLYAAAMGDY ILVLAISYTN       180
     PDERAALLEM LNTVSFK                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page