(data stored in ACNUC7421 zone)

EMBL: CP000859.PE161

CP000859.PE161       Location/Qualifiers
FT   CDS             complement(176276..177982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0161"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: sat:SYN_01216
FT                   potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65971"
FT                   /db_xref="GOA:A8ZSQ8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ8"
FT                   /protein_id="ABW65971.1"
FT                   /translation="MKTMATQLSLLLQADRRRGNIRLLVKFCLMLACFFVLYSVLFHVL
FT                   MVYEGRSYSWITGFYWTLTTMSTLGFGDITFTSDIGKVFSVVVLLSGIIFLLVMLPFTF
FT                   IQFFYAPWLEEQNKARTPRAVAEALSGHVIFTHYDDITIHLIRKLEQHHIRYVLLVADL
FT                   QAALNLHDQGYHVVVGDLDDPDTYPRLNVDRAALVVVLNDDVVSTNIIYTIREISPDVI
FT                   TVTNADREESLDILKLAGSTHVLQMTRMLGQALARRVYGVSMTANVIGRFDELLIAEAS
FT                   AMRTWLQGKTLAESRLRQVAGVTVVGIWEQGRFIMPGPHSRIGESTVLVLAGTEEQLNL
FT                   FDRSIAGKMADSHQKGPVLVIGGGRVGTAVADTLKGREVEFRVVEKRSDIASRHAHYIE
FT                   GSAAEREVLDRAGLQETPAVIITTHDDNLNIYLTIYIRRLRPDVQIISRSSLDRNITTL
FT                   HRAGANLVLSYSSLLNSTILNLLQPQKMLMLSEGLNMFRAALNEKMVSQALADLSIREQ
FT                   TGCSVMAVKRAGELIVNPDPAIVLEAGDELLLIGLTEAEKTFMERYPPDKK"
     MKTMATQLSL LLQADRRRGN IRLLVKFCLM LACFFVLYSV LFHVLMVYEG RSYSWITGFY        60
     WTLTTMSTLG FGDITFTSDI GKVFSVVVLL SGIIFLLVML PFTFIQFFYA PWLEEQNKAR       120
     TPRAVAEALS GHVIFTHYDD ITIHLIRKLE QHHIRYVLLV ADLQAALNLH DQGYHVVVGD       180
     LDDPDTYPRL NVDRAALVVV LNDDVVSTNI IYTIREISPD VITVTNADRE ESLDILKLAG       240
     STHVLQMTRM LGQALARRVY GVSMTANVIG RFDELLIAEA SAMRTWLQGK TLAESRLRQV       300
     AGVTVVGIWE QGRFIMPGPH SRIGESTVLV LAGTEEQLNL FDRSIAGKMA DSHQKGPVLV       360
     IGGGRVGTAV ADTLKGREVE FRVVEKRSDI ASRHAHYIEG SAAEREVLDR AGLQETPAVI       420
     ITTHDDNLNI YLTIYIRRLR PDVQIISRSS LDRNITTLHR AGANLVLSYS SLLNSTILNL       480
     LQPQKMLMLS EGLNMFRAAL NEKMVSQALA DLSIREQTGC SVMAVKRAGE LIVNPDPAIV       540
     LEAGDELLLI GLTEAEKTFM ERYPPDKK                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page