(data stored in ACNUC7421 zone)

EMBL: CP000859.PE167

CP000859.PE167       Location/Qualifiers
FT   CDS             complement(186392..187033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cac:CAC3687
FT                   transcriptional regulator, AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65977"
FT                   /db_xref="GOA:A8ZSR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR4"
FT                   /protein_id="ABW65977.1"
FT                   /translation="MTISKNKARIPVQKRSIETKEKILNAAWELFAEKGYFKTNTNELA
FT                   ERAGIATGSFYGYFNNKKEVGIELMMRFYKEVSKKALSNFYIQIGDNVAENLDTGRKLV
FT                   RFIIKSLKESHAINPLLHKETTALILLDEDVRNISSEEDKKIIAFLITLLQQHKQLIRV
FT                   DDIEAAAVLLFRTSDEIIHRIMIHKDAIDEDRLLKELEDMICSYLFITVS"
     MTISKNKARI PVQKRSIETK EKILNAAWEL FAEKGYFKTN TNELAERAGI ATGSFYGYFN        60
     NKKEVGIELM MRFYKEVSKK ALSNFYIQIG DNVAENLDTG RKLVRFIIKS LKESHAINPL       120
     LHKETTALIL LDEDVRNISS EEDKKIIAFL ITLLQQHKQL IRVDDIEAAA VLLFRTSDEI       180
     IHRIMIHKDA IDEDRLLKEL EDMICSYLFI TVS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page