(data stored in ACNUC7421 zone)

EMBL: CP000859.PE170

CP000859.PE170       Location/Qualifiers
FT   CDS             189216..189542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0170"
FT                   /product="DNA-binding protein"
FT                   /note="KEGG: gsu:GSU1390 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65980"
FT                   /db_xref="GOA:A8ZSR7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR7"
FT                   /protein_id="ABW65980.1"
FT                   /translation="MARIEKEELSGSVTIKTMRRIADGLDCVFVYGLVPRTSQGEAVAR
FT                   QAKQVAIKRLSQASQTMSLENQSLSRRENEQALSALVDELIQTLPSTLWDIGNYIPLLE
FT                   FAKS"
     MARIEKEELS GSVTIKTMRR IADGLDCVFV YGLVPRTSQG EAVARQAKQV AIKRLSQASQ        60
     TMSLENQSLS RRENEQALSA LVDELIQTLP STLWDIGNYI PLLEFAKS                    108
//

If you have problems or comments...

PBIL Back to PBIL home page