(data stored in ACNUC7421 zone)

EMBL: CP000859.PE171

CP000859.PE171       Location/Qualifiers
FT   CDS             complement(189575..191494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0171"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_0431 putative ATP-binding component of a
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65981"
FT                   /db_xref="GOA:A8ZSR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR8"
FT                   /protein_id="ABW65981.1"
FT                   /translation="MALISMQDVRWGFGEPYLLDGISFNIEKGERVGLLGRNGVGKSSL
FT                   FRLLTREILPDSGEIVIGQGIQVAALEQEVAAGRPCPSKMSPEVKETVFEVVARGLGPA
FT                   GQNLADFYRVCSAMASSHEPRLSDERERLQHALDTGGGWVLQQQIENILSRTDLDPKRP
FT                   FADLSAGMKRRALFARSLALSPDLLLLDEPTNHMDIDSIVWMESFLLRHVKTLLFITHD
FT                   RVFLERIATRIMVLDRGRLFSYACDYKTYLQRREAELAAEAEHQRNFDKKLSKEEAWIR
FT                   QGIKARRTRNEGRVRALQEMRAKVRQRRAKTGQVRLALQEAERTGKLVVQAEGLTYAYD
FT                   QTPIVQNFSTTILRGDKVGIIGPNGVGKTTLIRLLLGALAPDSGTVRHGTHLEPAYFDQ
FT                   LRTQLDEQKTVVQNISMDNDFIVFNGQKRHVIGYLQDFLFSPERCRTPVHVLSGGERNR
FT                   LLLAKLFIRPANLLVLDEPTNDLDAETLELLEELLFSYDGTLLLVSHDRSFLNHIVTST
FT                   LVFEGNGQVVEYAGGYDDWLAQRPQPVAPEAAVPKQAQPPRQAPPAKPKKLTFAQNREL
FT                   KELPAMIEALETEQRLLQAAMADPAFYRQAKEEIKARQKRLQEVEDKISACYRRWEELE
FT                   DLTP"
     MALISMQDVR WGFGEPYLLD GISFNIEKGE RVGLLGRNGV GKSSLFRLLT REILPDSGEI        60
     VIGQGIQVAA LEQEVAAGRP CPSKMSPEVK ETVFEVVARG LGPAGQNLAD FYRVCSAMAS       120
     SHEPRLSDER ERLQHALDTG GGWVLQQQIE NILSRTDLDP KRPFADLSAG MKRRALFARS       180
     LALSPDLLLL DEPTNHMDID SIVWMESFLL RHVKTLLFIT HDRVFLERIA TRIMVLDRGR       240
     LFSYACDYKT YLQRREAELA AEAEHQRNFD KKLSKEEAWI RQGIKARRTR NEGRVRALQE       300
     MRAKVRQRRA KTGQVRLALQ EAERTGKLVV QAEGLTYAYD QTPIVQNFST TILRGDKVGI       360
     IGPNGVGKTT LIRLLLGALA PDSGTVRHGT HLEPAYFDQL RTQLDEQKTV VQNISMDNDF       420
     IVFNGQKRHV IGYLQDFLFS PERCRTPVHV LSGGERNRLL LAKLFIRPAN LLVLDEPTND       480
     LDAETLELLE ELLFSYDGTL LLVSHDRSFL NHIVTSTLVF EGNGQVVEYA GGYDDWLAQR       540
     PQPVAPEAAV PKQAQPPRQA PPAKPKKLTF AQNRELKELP AMIEALETEQ RLLQAAMADP       600
     AFYRQAKEEI KARQKRLQEV EDKISACYRR WEELEDLTP                              639
//

If you have problems or comments...

PBIL Back to PBIL home page