(data stored in ACNUC7421 zone)

EMBL: CP000859.PE178

CP000859.PE178       Location/Qualifiers
FT   CDS             197194..198024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0178"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   afu:AF1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65988"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS5"
FT                   /protein_id="ABW65988.1"
FT                   /translation="MTLTDFQQLGKELYEKLHLPTYPVAITYIKSEDEIPAKAMRPSAM
FT                   GQKMCICQTFTYARSWGAHVAITAEENFCVPGSAGHKWVDVTDEEFIESQVTQGWHKSR
FT                   EAEINRINGYNMLFAGPEGQARLARAKARIGLVASPLHQALMVPDTVLVFGNGVHITHI
FT                   IQALCYDYKAPIMSVFEGFGESCMMGGMIPFLTGQPQIVIPGMGDRAFAGITPDEIGIG
FT                   IPAAKFPVVLEDLFKTGGPMNIGMPFKTMIPTNLTEDITPGFAYLKKIVDEKSR"
     MTLTDFQQLG KELYEKLHLP TYPVAITYIK SEDEIPAKAM RPSAMGQKMC ICQTFTYARS        60
     WGAHVAITAE ENFCVPGSAG HKWVDVTDEE FIESQVTQGW HKSREAEINR INGYNMLFAG       120
     PEGQARLARA KARIGLVASP LHQALMVPDT VLVFGNGVHI THIIQALCYD YKAPIMSVFE       180
     GFGESCMMGG MIPFLTGQPQ IVIPGMGDRA FAGITPDEIG IGIPAAKFPV VLEDLFKTGG       240
     PMNIGMPFKT MIPTNLTEDI TPGFAYLKKI VDEKSR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page