(data stored in ACNUC7421 zone)

EMBL: CP000859.PE179

CP000859.PE179       Location/Qualifiers
FT   CDS             198054..198575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65989"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS6"
FT                   /protein_id="ABW65989.1"
FT                   /translation="MAASREQVLETAFNAAKQYEMKSGGCPQCTLAGIFDALEVQNDDV
FT                   FRAATGLADGVGLTGEGHCGAISGGVLAIGYLFGRKKKDFGDMFKLVEANLLSKKLLDR
FT                   FMEKYGTCRCADLQTAFFGRFFNLLDPNDLNAAMEAGMLERCSTLAGEVARMTTEIILE
FT                   AREKKELSTK"
     MAASREQVLE TAFNAAKQYE MKSGGCPQCT LAGIFDALEV QNDDVFRAAT GLADGVGLTG        60
     EGHCGAISGG VLAIGYLFGR KKKDFGDMFK LVEANLLSKK LLDRFMEKYG TCRCADLQTA       120
     FFGRFFNLLD PNDLNAAMEA GMLERCSTLA GEVARMTTEI ILEAREKKEL STK              173
//

If you have problems or comments...

PBIL Back to PBIL home page