(data stored in ACNUC7421 zone)

EMBL: CP000859.PE181

CP000859.PE181       Location/Qualifiers
FT   CDS             199141..200208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0181"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_3864 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65991"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS8"
FT                   /protein_id="ABW65991.1"
FT                   /translation="MTRDIYRELQERLDLFSIGFPPAPSGVEITILKRLFSEEDADLFL
FT                   KLTPLLTPAEKIAETLGLLADEARTRLADMAGRGLLFSKTKGDTTLYAATPFVHGIFEY
FT                   QVNRMDKELAELMNQYGMEALGLNMLQHGGSFLRTIPVNQALTPDNQVASYDDALEILK
FT                   SKRTIVVTECICRKKQTILENACGKVVEACFMFDTMAEYYLAHNLGRQVTVDEAVDILG
FT                   KAREQGLVTQPATAQNPDGMCNCCGDCCGVLQAINFHPKPAEAVSTNHYAVLDRDACTG
FT                   CETCVDRCQTNALAMDDDGLAVLNPDRCIGCGLCVITCPSEALSLQAKSPEQQYQLPKD
FT                   GMDQMVALAQKRGIL"
     MTRDIYRELQ ERLDLFSIGF PPAPSGVEIT ILKRLFSEED ADLFLKLTPL LTPAEKIAET        60
     LGLLADEART RLADMAGRGL LFSKTKGDTT LYAATPFVHG IFEYQVNRMD KELAELMNQY       120
     GMEALGLNML QHGGSFLRTI PVNQALTPDN QVASYDDALE ILKSKRTIVV TECICRKKQT       180
     ILENACGKVV EACFMFDTMA EYYLAHNLGR QVTVDEAVDI LGKAREQGLV TQPATAQNPD       240
     GMCNCCGDCC GVLQAINFHP KPAEAVSTNH YAVLDRDACT GCETCVDRCQ TNALAMDDDG       300
     LAVLNPDRCI GCGLCVITCP SEALSLQAKS PEQQYQLPKD GMDQMVALAQ KRGIL            355
//

If you have problems or comments...

PBIL Back to PBIL home page