(data stored in ACNUC7421 zone)

EMBL: CP000859.PE182

CP000859.PE182       Location/Qualifiers
FT   CDS             200407..201270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0182"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ppd:Ppro_1081 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65992"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS9"
FT                   /protein_id="ABW65992.1"
FT                   /translation="MFDEQWFVNEIKQKIATHAENRLEYPYPTEPIFDEPLVGFVKGDD
FT                   PIFQELKTVIGPHHYTPREIMAWQAKKNHVPPPPAEELSVVSYVMPITRATKQQNAKRT
FT                   DWPAERWAQTRLSGEIFSQEFTREIVSFLMSRGVLAIAPDVTPLFNKKRYPNVGWASPW
FT                   SHRHIAYAAGLGTFGMHDFLITEKGCAHRLGSFVVHRRLAPNRRRPDDIHAYCLQYQGK
FT                   QCLKCARRCPVGAISKENAHNKETCYKHVAASLKYCLKNYHIFIYGCGICATGVPCESG
FT                   IPVKQK"
     MFDEQWFVNE IKQKIATHAE NRLEYPYPTE PIFDEPLVGF VKGDDPIFQE LKTVIGPHHY        60
     TPREIMAWQA KKNHVPPPPA EELSVVSYVM PITRATKQQN AKRTDWPAER WAQTRLSGEI       120
     FSQEFTREIV SFLMSRGVLA IAPDVTPLFN KKRYPNVGWA SPWSHRHIAY AAGLGTFGMH       180
     DFLITEKGCA HRLGSFVVHR RLAPNRRRPD DIHAYCLQYQ GKQCLKCARR CPVGAISKEN       240
     AHNKETCYKH VAASLKYCLK NYHIFIYGCG ICATGVPCES GIPVKQK                     287
//

If you have problems or comments...

PBIL Back to PBIL home page