(data stored in ACNUC7421 zone)

EMBL: CP000859.PE183

CP000859.PE183       Location/Qualifiers
FT   CDS             201532..202692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0183"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0095 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65993"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST0"
FT                   /protein_id="ABW65993.1"
FT                   /translation="MPKAADPYKKLNNILNMFDLKVPKSRKFTKLLKLLYTPEEAELLG
FT                   HFGTPYMHMEPIGTTVRITGRNKEDVEALFENMVKKGTLFFQKGDNGERLYSLPPFIPG
FT                   IYEFYTMSENDPFETKKDILKLLDDYFFETFVPEAFNSSNYPWFRVLPAEHPVKRTISI
FT                   EKSVDARTRILPFEIASEYISSAQYIAVGDCACRDHAAMQDGKPRCDKPKDVCLVFESV
FT                   AEYWVEKGIGRRITHEEAVNVLQRSAEAGLVHCTTNNRVFGERMSGMICNCCPCCCFIL
FT                   QGVLRTRGQQGIAKSNFQPVIKTEECNLCMACVDKCPVNALYHHKPHKDDGSDNFIALN
FT                   ESECLGCGVCVMACDNEAIQLVKVRDTVPEIDVLHMGDRHNKERRH"
     MPKAADPYKK LNNILNMFDL KVPKSRKFTK LLKLLYTPEE AELLGHFGTP YMHMEPIGTT        60
     VRITGRNKED VEALFENMVK KGTLFFQKGD NGERLYSLPP FIPGIYEFYT MSENDPFETK       120
     KDILKLLDDY FFETFVPEAF NSSNYPWFRV LPAEHPVKRT ISIEKSVDAR TRILPFEIAS       180
     EYISSAQYIA VGDCACRDHA AMQDGKPRCD KPKDVCLVFE SVAEYWVEKG IGRRITHEEA       240
     VNVLQRSAEA GLVHCTTNNR VFGERMSGMI CNCCPCCCFI LQGVLRTRGQ QGIAKSNFQP       300
     VIKTEECNLC MACVDKCPVN ALYHHKPHKD DGSDNFIALN ESECLGCGVC VMACDNEAIQ       360
     LVKVRDTVPE IDVLHMGDRH NKERRH                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page