(data stored in ACNUC7421 zone)

EMBL: CP000859.PE187

CP000859.PE187       Location/Qualifiers
FT   CDS             205948..206940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0187"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sfu:Sfum_1905 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65997"
FT                   /db_xref="GOA:A8ZST4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST4"
FT                   /protein_id="ABW65997.1"
FT                   /translation="MKPNLLTDRFGRHLSYLRVSVTDRCNLNCLYCRRWDFSEYFPSSE
FT                   ILSYEEMLRLIHIGAGLGITKIRITGGEPFVRKDACSFIDRVAAFDGISDISVTTNGLL
FT                   LGRYLDRLRQAGIRRLNISLDSLKREKYRLITGRDVFHTVWDNIMAALDAGFDPVKVNV
FT                   VVMREVNDDEISRFADLTFRFPLHIRFIEYMPSCKYHLDSYRQMFTPEIRERVEANGAL
FT                   IPIETADSSNIAHRFKYHGAKGEIGFISPMSSHFCAACNRLRLTADGMLRPCLLSDRFV
FT                   NIKTPMRNGLTDREIEGLFHLAVLYKPRSSGINQACGARLPELMSAIGG"
     MKPNLLTDRF GRHLSYLRVS VTDRCNLNCL YCRRWDFSEY FPSSEILSYE EMLRLIHIGA        60
     GLGITKIRIT GGEPFVRKDA CSFIDRVAAF DGISDISVTT NGLLLGRYLD RLRQAGIRRL       120
     NISLDSLKRE KYRLITGRDV FHTVWDNIMA ALDAGFDPVK VNVVVMREVN DDEISRFADL       180
     TFRFPLHIRF IEYMPSCKYH LDSYRQMFTP EIRERVEANG ALIPIETADS SNIAHRFKYH       240
     GAKGEIGFIS PMSSHFCAAC NRLRLTADGM LRPCLLSDRF VNIKTPMRNG LTDREIEGLF       300
     HLAVLYKPRS SGINQACGAR LPELMSAIGG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page