(data stored in ACNUC7421 zone)

EMBL: CP000859.PE189

CP000859.PE189       Location/Qualifiers
FT   CDS             complement(207371..208126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0189"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: pth:PTH_2704
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65999"
FT                   /db_xref="GOA:A8ZST6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST6"
FT                   /protein_id="ABW65999.1"
FT                   /translation="MEKKTKQPAAKTPPAPLSMTGLAKASGVSPKTVRTYIDAGLLPPP
FT                   EKKRGTTAYYDARCVNMINMIDRFHSKYSLPLPIIRQVIDEIGHEKALEESGELTKKLN
FT                   RAKKMPWFEHIVDANSKPFLTKKALILATGLSPKDLDKAIAQKLIMPDKNGLFCKNDMD
FT                   LALLLSQLKGTGAGKEKILLDFLNMQLQMTESLVEKEFNAFFKNIINKNITVEDANELA
FT                   EKAIDVLTTLLPLCYRQLLNRKIEELRKT"
     MEKKTKQPAA KTPPAPLSMT GLAKASGVSP KTVRTYIDAG LLPPPEKKRG TTAYYDARCV        60
     NMINMIDRFH SKYSLPLPII RQVIDEIGHE KALEESGELT KKLNRAKKMP WFEHIVDANS       120
     KPFLTKKALI LATGLSPKDL DKAIAQKLIM PDKNGLFCKN DMDLALLLSQ LKGTGAGKEK       180
     ILLDFLNMQL QMTESLVEKE FNAFFKNIIN KNITVEDANE LAEKAIDVLT TLLPLCYRQL       240
     LNRKIEELRK T                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page