(data stored in ACNUC7421 zone)

EMBL: CP000859.PE19

CP000859.PE19        Location/Qualifiers
FT   CDS             complement(20373..20849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0019"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bsu:BG11650 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65829"
FT                   /db_xref="GOA:A8ZRR2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR2"
FT                   /protein_id="ABW65829.1"
FT                   /translation="MNPVMLVVILQLVAVVIIIAEVIIPSGGLLSLLAAGLIGYSLYTV
FT                   FGQISVDAGYLLIGIDVVVLPLVILLGLKLLARSPATLRAELSTGAGVTSQRPDMEGLM
FT                   GKKGTALSDLRPSGVAMIEGKRVDVVSRGAYIDRNSEVVVRAVTGNQVIVTTPE"
     MNPVMLVVIL QLVAVVIIIA EVIIPSGGLL SLLAAGLIGY SLYTVFGQIS VDAGYLLIGI        60
     DVVVLPLVIL LGLKLLARSP ATLRAELSTG AGVTSQRPDM EGLMGKKGTA LSDLRPSGVA       120
     MIEGKRVDVV SRGAYIDRNS EVVVRAVTGN QVIVTTPE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page