(data stored in ACNUC7421 zone)

EMBL: CP000859.PE190

CP000859.PE190       Location/Qualifiers
FT   CDS             complement(208138..208707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0190"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: sat:SYN_00638 tungsten formylmethanofuran
FT                   dehydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66000"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST7"
FT                   /protein_id="ABW66000.1"
FT                   /translation="MICGRTPDELIRDIEGFHGFVAPGLVIGAFMVDLAREHIGQNTEA
FT                   DAVVETRHCLPDAVQILTPCTVGNGWLKIADLDKFALTLYDRHTFAGFRVWLDLNKAKA
FT                   HPNVYNWFMGLVSKKDLPKEILIPAIFDAGRDILSVKPVTVRAEFAKREKKSKIAVCPA
FT                   CNEAYAAAQGTPCLACQGKDYYHTGS"
     MICGRTPDEL IRDIEGFHGF VAPGLVIGAF MVDLAREHIG QNTEADAVVE TRHCLPDAVQ        60
     ILTPCTVGNG WLKIADLDKF ALTLYDRHTF AGFRVWLDLN KAKAHPNVYN WFMGLVSKKD       120
     LPKEILIPAI FDAGRDILSV KPVTVRAEFA KREKKSKIAV CPACNEAYAA AQGTPCLACQ       180
     GKDYYHTGS                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page