(data stored in ACNUC7421 zone)

EMBL: CP000859.PE192

CP000859.PE192       Location/Qualifiers
FT   CDS             209441..210022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0192"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   sus:Acid_4388 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66002"
FT                   /db_xref="GOA:A8ZST9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST9"
FT                   /protein_id="ABW66002.1"
FT                   /translation="MSSRVTTSESISLPGQKDASAGGFSRREFLGKGLAVAGWGVMFAS
FT                   LGAGLYQGIRFLYPAVVFHPPSTYVIGQLKDFVTDERADQYGVIFVDPKFKKDHRFFVV
FT                   REAGRIYSLFARCTHLGCTVNWFEELNIFKCPCHGSEFHSNGVEFAGPAPRPLDRHHIA
FT                   VDNGGNIIVDTARVYSKDEFEEQKIFIEVG"
     MSSRVTTSES ISLPGQKDAS AGGFSRREFL GKGLAVAGWG VMFASLGAGL YQGIRFLYPA        60
     VVFHPPSTYV IGQLKDFVTD ERADQYGVIF VDPKFKKDHR FFVVREAGRI YSLFARCTHL       120
     GCTVNWFEEL NIFKCPCHGS EFHSNGVEFA GPAPRPLDRH HIAVDNGGNI IVDTARVYSK       180
     DEFEEQKIFI EVG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page