(data stored in ACNUC7421 zone)

EMBL: CP000859.PE193

CP000859.PE193       Location/Qualifiers
FT   CDS             210022..210387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_3885 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66003"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU0"
FT                   /protein_id="ABW66003.1"
FT                   /translation="MTGSVAAIQEAPAALPKKARAPKRQAMILDWCTGCGGVPVCRIYC
FT                   KFDALQLVDDPDNYPFKRMTVNRVRCVGCGACISSGPDGLVLTGCPWNAIRLVPVENNP
FT                   HSDSEKEETRGADQPAV"
     MTGSVAAIQE APAALPKKAR APKRQAMILD WCTGCGGVPV CRIYCKFDAL QLVDDPDNYP        60
     FKRMTVNRVR CVGCGACISS GPDGLVLTGC PWNAIRLVPV ENNPHSDSEK EETRGADQPA       120
     V                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page