(data stored in ACNUC7421 zone)

EMBL: CP000859.PE194

CP000859.PE194       Location/Qualifiers
FT   CDS             210524..213505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0194"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: eba:ebA5790 ethylbenzene
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66004"
FT                   /db_xref="GOA:A8ZSU1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU1"
FT                   /protein_id="ABW66004.1"
FT                   /translation="MKEVKISRRTFLKGTSATVALLSLNSLGFLGGNTIANATEKIFED
FT                   WKYAGWENLHREEWTWDKVTYGTHLVDCYPGNCLWRVYSKDGVVFREEQAAKYPVIDPS
FT                   GPDFNPRGCQKGASYSLQMYNPDRLKYPMKQVGGRGSGKWKRVSWDQCLAEIAEGIVDG
FT                   LEAQGPESIIFESGPGNGGYVHVMAVHRLMVSLGATVLDLDSTIGDFNRGIYETFGKFM
FT                   FMDSVDGWYFGKLLLIWHMNPVYTRIPSYHFISEARYNGAEIISIAPDYNPSCMHADEY
FT                   IPVEMGSDAALGLAVCQVLMNKKWVDYPFVKEQSDLPLLVRKDTDRFLSAADIEKGARD
FT                   DQFCFWDSKNNKVVKAPLETLKLPCDPALEGVYKATLLDGKTVEVEPVFNKLKALLDSE
FT                   YTPEQASEMCRTNPDTIRRMAEKCYKASGGIQVMVGWNSPKYYHGDLIERAMCLVLTLT
FT                   GSLGKKGCGIRGWNESLFEGAFTQIFKQKIGLMNLTRQLPLMRRVWESFKKEDPTISDE
FT                   MASIKQERVIDRNMVNYTIPAFLYYNHSNYKKAWDNKAWHCPTMKREFKEYYDEAVNSG
FT                   WWDGYVKPEKDQTPTVYCWMGTNPARKNRGWEKNILGSLWDKYKTIFGFETRWTTTLLY
FT                   GDYALPCAGFYEKLDTRFPTPHVPWLTLTDEAVKPIGECKTEWEICLMLAKKIEEAAKK
FT                   RGKTNFVPRTPVQEEYMPFLNQFSVRDAKGNVEISKLHDWQLMGSSGKDFDEIMEDALQ
FT                   SSVMLGNLPPGTNLKYMREHGIVRFVDVSIFDPVTMNLATDIKPDEPIIPLTWHTGEKK
FT                   VPYPTYNRRIQFYIDHPWFLEAKEELPVHKDNPKIGGNYPLRLTSGHQRWSIHSIWVSN
FT                   EQLLRTHQGRPFMFMSPEDAEKRGVEDGDLVRVFNDFASFKIHVKVTPAARPEKGAAKP
FT                   GQVIIYHAWEPFMFPEWKSYDIAIPGMIKWLDLVNNYGHLHYWRWNWCAQPIDRGISVN
FT                   VEKA"
     MKEVKISRRT FLKGTSATVA LLSLNSLGFL GGNTIANATE KIFEDWKYAG WENLHREEWT        60
     WDKVTYGTHL VDCYPGNCLW RVYSKDGVVF REEQAAKYPV IDPSGPDFNP RGCQKGASYS       120
     LQMYNPDRLK YPMKQVGGRG SGKWKRVSWD QCLAEIAEGI VDGLEAQGPE SIIFESGPGN       180
     GGYVHVMAVH RLMVSLGATV LDLDSTIGDF NRGIYETFGK FMFMDSVDGW YFGKLLLIWH       240
     MNPVYTRIPS YHFISEARYN GAEIISIAPD YNPSCMHADE YIPVEMGSDA ALGLAVCQVL       300
     MNKKWVDYPF VKEQSDLPLL VRKDTDRFLS AADIEKGARD DQFCFWDSKN NKVVKAPLET       360
     LKLPCDPALE GVYKATLLDG KTVEVEPVFN KLKALLDSEY TPEQASEMCR TNPDTIRRMA       420
     EKCYKASGGI QVMVGWNSPK YYHGDLIERA MCLVLTLTGS LGKKGCGIRG WNESLFEGAF       480
     TQIFKQKIGL MNLTRQLPLM RRVWESFKKE DPTISDEMAS IKQERVIDRN MVNYTIPAFL       540
     YYNHSNYKKA WDNKAWHCPT MKREFKEYYD EAVNSGWWDG YVKPEKDQTP TVYCWMGTNP       600
     ARKNRGWEKN ILGSLWDKYK TIFGFETRWT TTLLYGDYAL PCAGFYEKLD TRFPTPHVPW       660
     LTLTDEAVKP IGECKTEWEI CLMLAKKIEE AAKKRGKTNF VPRTPVQEEY MPFLNQFSVR       720
     DAKGNVEISK LHDWQLMGSS GKDFDEIMED ALQSSVMLGN LPPGTNLKYM REHGIVRFVD       780
     VSIFDPVTMN LATDIKPDEP IIPLTWHTGE KKVPYPTYNR RIQFYIDHPW FLEAKEELPV       840
     HKDNPKIGGN YPLRLTSGHQ RWSIHSIWVS NEQLLRTHQG RPFMFMSPED AEKRGVEDGD       900
     LVRVFNDFAS FKIHVKVTPA ARPEKGAAKP GQVIIYHAWE PFMFPEWKSY DIAIPGMIKW       960
     LDLVNNYGHL HYWRWNWCAQ PIDRGISVNV EKA                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page