(data stored in ACNUC7421 zone)

EMBL: CP000859.PE195

CP000859.PE195       Location/Qualifiers
FT   CDS             213550..214215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0195"
FT                   /product="gamma-subunit of ethylbenzene dehydrogenase"
FT                   /note="KEGG: eba:c1A62 gamma-subunit of ethylbenzene
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66005"
FT                   /db_xref="GOA:A8ZSU2"
FT                   /db_xref="InterPro:IPR017838"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU2"
FT                   /protein_id="ABW66005.1"
FT                   /translation="MEKVICKKIATATKELLNCDSSVWQSGKAVLETAATPLANQPSPY
FT                   IKGVYDETKIGAVKKITIKAVHNGKDIVFYCEWESGKPNKEIGDINVFPDGVALLFPFK
FT                   DIDKTPINEMGTQDYPTNAWYWRPDFEEKPKNQVSHGLSTSLYTEKSSISSYSRWANGK
FT                   WCVVMARPMKATQPGEETVDLMPGKAIGFGIAVWEGSNGERGGIKAFSKEWRELVIEA"
     MEKVICKKIA TATKELLNCD SSVWQSGKAV LETAATPLAN QPSPYIKGVY DETKIGAVKK        60
     ITIKAVHNGK DIVFYCEWES GKPNKEIGDI NVFPDGVALL FPFKDIDKTP INEMGTQDYP       120
     TNAWYWRPDF EEKPKNQVSH GLSTSLYTEK SSISSYSRWA NGKWCVVMAR PMKATQPGEE       180
     TVDLMPGKAI GFGIAVWEGS NGERGGIKAF SKEWRELVIE A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page