(data stored in ACNUC7421 zone)

EMBL: CP000859.PE20

CP000859.PE20        Location/Qualifiers
FT   CDS             complement(20846..22312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0020"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   rba:RB7673 conserved hypothetical protein-putative
FT                   periplasmatic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65830"
FT                   /db_xref="GOA:A8ZRR3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR3"
FT                   /protein_id="ABW65830.1"
FT                   /translation="MKRLFLIFCLLVSGFFLVAPGPVSAGDAHTVYVVKVAGDVAPGMA
FT                   AYLKRALDDIPEAPHQTIVLDLDTFGGRVDSALMIVDLITAADSKGKTIAFVSRKAISA
FT                   GALIALACNELVMKPGTTIGDCAPIMVGSQGPEMLGEKFQSPLRAKFRALAKKNGYPEA
FT                   LAESMVTADMEVFRVVTKDGGTFYMDALEYEEMDEAQKSAVVSKKTVVAKGELLTMDDI
FT                   EARDLGFSQMTVSSVKEMLAAMGIDDTDIVVMEQQWSEGLMRWLGTLAPLLMLIGLGAL
FT                   YTEIKSPGFGVPGIVGIICLALFFMNQYAVGLADYTELLIFLLGLVLIGIETFVLPGFG
FT                   IAGIAGAVCIIVSFVLAMQGFVLPDPDMPWQTDLMVNNVIQVLGAVVTAFLAALFLLRF
FT                   VLPRLSAVVSGPYLSATLSEARADATANTGAGVGDRGTAATSLRPAGKMKIGPEMYDVV
FT                   TEGEFLDKGTPVVIIAVRGNVLVVSRETTQ"
     MKRLFLIFCL LVSGFFLVAP GPVSAGDAHT VYVVKVAGDV APGMAAYLKR ALDDIPEAPH        60
     QTIVLDLDTF GGRVDSALMI VDLITAADSK GKTIAFVSRK AISAGALIAL ACNELVMKPG       120
     TTIGDCAPIM VGSQGPEMLG EKFQSPLRAK FRALAKKNGY PEALAESMVT ADMEVFRVVT       180
     KDGGTFYMDA LEYEEMDEAQ KSAVVSKKTV VAKGELLTMD DIEARDLGFS QMTVSSVKEM       240
     LAAMGIDDTD IVVMEQQWSE GLMRWLGTLA PLLMLIGLGA LYTEIKSPGF GVPGIVGIIC       300
     LALFFMNQYA VGLADYTELL IFLLGLVLIG IETFVLPGFG IAGIAGAVCI IVSFVLAMQG       360
     FVLPDPDMPW QTDLMVNNVI QVLGAVVTAF LAALFLLRFV LPRLSAVVSG PYLSATLSEA       420
     RADATANTGA GVGDRGTAAT SLRPAGKMKI GPEMYDVVTE GEFLDKGTPV VIIAVRGNVL       480
     VVSRETTQ                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page