(data stored in ACNUC7421 zone)

EMBL: CP000859.PE201

CP000859.PE201       Location/Qualifiers
FT   CDS             220159..222813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0201"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gsu:GSU2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66011"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU8"
FT                   /protein_id="ABW66011.1"
FT                   /translation="MFFRAHISASVVRLTAVVLFMVMFLPACSLYRVTHLDKYENFAEI
FT                   SNTLWAKLYFVFKDVDLPGYDAIIYADTRWRVSDSPVVIDKNTFILPGVYLTIDPGVEV
FT                   RLAKDILVTNRGVIVARGTPEAPIRFTWQTEGENWNAIENLNCVGRTGKSSEVVYEHCI
FT                   IEHGQGLAINSSLGRVESCVFRHNIDSALKFQYAEGAILNSTFYQNSSERQAESGNGAA
FT                   INVYSDKSVRVENNDVYDNYSHGGRDGGGGIYAFAYNDGVVEVVNNRVRNNRSDRKAGG
FT                   IFAYAARVSSNTVIDNEAAMTGGGIHVIEGGLEKNVIAGNRAPNGGGIYSEAGRLKGNL
FT                   VRANQSDNGAGLYHLGGGEILGNTFVENTCTGKETCATITLSGSPVISRNNILARTGYA
FT                   LSFKSHSLSPDLKAHENYWGTTDKQAVEQLVSDWLEDSRVGLVNWNAYLSAPAPDACPI
FT                   PENADTTVLVDVPSMPANAIRGLVEADTLLGKDGIRSYSVVGNLLVLDGNTLTLAPGTT
FT                   LKLNPDVTIRVRGTLNAEGTAKQPVRFTGDRKTPWGQLFFENRSTGPAQTEDETTRPPD
FT                   SRLRHCIVENGGGIMMDGHGADLYDCVVRNHRGTGARIKEVSVSVKNCDIYGNVSDSDG
FT                   GGLYVYGSRTVFIEGNRIADNRAADGGGIFAYGYQSNAAVDIRNNRIEGNISEGDGGGV
FT                   WMSRSALVNNLIIRNKTEAKGGGLYAGFALIEDNRISENRAAEGGGVFAEANCSFKRNV
FT                   ISHNTATSPRGGGVYLNYWGLSQHNKEFLGNRVENNTAAGARPTGGVMMNGQMDFRQNS
FT                   LTGNNGIQLYNLNAADVKDIVAPSCYWGTVSEKAVDGLIYDGKDNDRLSVVDFRPLAKT
FT                   REAAITNAESKPE"
     MFFRAHISAS VVRLTAVVLF MVMFLPACSL YRVTHLDKYE NFAEISNTLW AKLYFVFKDV        60
     DLPGYDAIIY ADTRWRVSDS PVVIDKNTFI LPGVYLTIDP GVEVRLAKDI LVTNRGVIVA       120
     RGTPEAPIRF TWQTEGENWN AIENLNCVGR TGKSSEVVYE HCIIEHGQGL AINSSLGRVE       180
     SCVFRHNIDS ALKFQYAEGA ILNSTFYQNS SERQAESGNG AAINVYSDKS VRVENNDVYD       240
     NYSHGGRDGG GGIYAFAYND GVVEVVNNRV RNNRSDRKAG GIFAYAARVS SNTVIDNEAA       300
     MTGGGIHVIE GGLEKNVIAG NRAPNGGGIY SEAGRLKGNL VRANQSDNGA GLYHLGGGEI       360
     LGNTFVENTC TGKETCATIT LSGSPVISRN NILARTGYAL SFKSHSLSPD LKAHENYWGT       420
     TDKQAVEQLV SDWLEDSRVG LVNWNAYLSA PAPDACPIPE NADTTVLVDV PSMPANAIRG       480
     LVEADTLLGK DGIRSYSVVG NLLVLDGNTL TLAPGTTLKL NPDVTIRVRG TLNAEGTAKQ       540
     PVRFTGDRKT PWGQLFFENR STGPAQTEDE TTRPPDSRLR HCIVENGGGI MMDGHGADLY       600
     DCVVRNHRGT GARIKEVSVS VKNCDIYGNV SDSDGGGLYV YGSRTVFIEG NRIADNRAAD       660
     GGGIFAYGYQ SNAAVDIRNN RIEGNISEGD GGGVWMSRSA LVNNLIIRNK TEAKGGGLYA       720
     GFALIEDNRI SENRAAEGGG VFAEANCSFK RNVISHNTAT SPRGGGVYLN YWGLSQHNKE       780
     FLGNRVENNT AAGARPTGGV MMNGQMDFRQ NSLTGNNGIQ LYNLNAADVK DIVAPSCYWG       840
     TVSEKAVDGL IYDGKDNDRL SVVDFRPLAK TREAAITNAE SKPE                        884
//

If you have problems or comments...

PBIL Back to PBIL home page