(data stored in ACNUC7421 zone)

EMBL: CP000859.PE203

CP000859.PE203       Location/Qualifiers
FT   CDS             224226..225737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0203"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   csc:Csac_1797 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66013"
FT                   /db_xref="GOA:A8ZSV0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV0"
FT                   /protein_id="ABW66013.1"
FT                   /translation="MISRSQTKALLEREPKFDDMMGSLRATGKQPKGVIGEVRKLMAVA
FT                   RRFNDSYTSGYWRELDLKMHEDPDYLPWEVVKKANELNFYSLFIPKIFGGKGYSISGIG
FT                   PFLEEIGSVCASVANLIGVHYLGFVGLAASWNMRLTDMVCREVVNGEKTGEPCLMSFAM
FT                   TEPDAGTDSQNVEFMDTGSLACHAEKVEGGYKVNGTKIFISCGHLSTWHILFAYTDPAK
FT                   GSESMVMMAVKNGTKGFSFGKKEKKMGQKASLASELVFKDCFVPDDMVLLDKTQSAGLS
FT                   RSPRDITELILANIWAASRVGVAAFGSSAAKGAFEQALRFASETEVDGRPLVTHEWCQA
FT                   MLAEMYKNAAVARMAYSEGAYINGMDGMVKMLNIKPLYYMMKYTPVSLLDPIMKPINKM
FT                   GFTTWISRKIAFDWVDDAAVDRTDGWGSLVKFTATDMGMQNGRMALELMGGAGVRHSEH
FT                   AEKILRDAKLFQIYEGTNQINRINVFKRLVARTCPGTECFCSANL"
     MISRSQTKAL LEREPKFDDM MGSLRATGKQ PKGVIGEVRK LMAVARRFND SYTSGYWREL        60
     DLKMHEDPDY LPWEVVKKAN ELNFYSLFIP KIFGGKGYSI SGIGPFLEEI GSVCASVANL       120
     IGVHYLGFVG LAASWNMRLT DMVCREVVNG EKTGEPCLMS FAMTEPDAGT DSQNVEFMDT       180
     GSLACHAEKV EGGYKVNGTK IFISCGHLST WHILFAYTDP AKGSESMVMM AVKNGTKGFS       240
     FGKKEKKMGQ KASLASELVF KDCFVPDDMV LLDKTQSAGL SRSPRDITEL ILANIWAASR       300
     VGVAAFGSSA AKGAFEQALR FASETEVDGR PLVTHEWCQA MLAEMYKNAA VARMAYSEGA       360
     YINGMDGMVK MLNIKPLYYM MKYTPVSLLD PIMKPINKMG FTTWISRKIA FDWVDDAAVD       420
     RTDGWGSLVK FTATDMGMQN GRMALELMGG AGVRHSEHAE KILRDAKLFQ IYEGTNQINR       480
     INVFKRLVAR TCPGTECFCS ANL                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page