(data stored in ACNUC7421 zone)

EMBL: CP000859.PE204

CP000859.PE204       Location/Qualifiers
FT   CDS             225801..226913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0204"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ttj:TTHA1916
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66014"
FT                   /db_xref="GOA:A8ZRZ6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ6"
FT                   /protein_id="ABW66014.1"
FT                   /translation="MYASDNKELSLLDKSSAEFAKKILAPGREENDHYPFGPFFDPVVQ
FT                   KAFDLDFFHILLPEDLGGVGQGIEALCIVLANICREDSSLGGIMFTNAFAQNLLLAAGC
FT                   TGELKDLAAGAKKPSDFLIACPVLCNPVQQPLRLSARKEGDGYVLSGTAEYVVLGGMAN
FT                   HALLPATLADGHAWFLVNLPDGAISVSDPVVSHGMHACPATDMTLKDAAARLVGAEEEG
FT                   PAYFKKVADTMQLAAAAMAAGVMRGSLEEALAYCRERRQGGRKIKDWSELQMLLSSMAV
FT                   QVHVAEMLVSRACRALSEDAKNWRLSVQAAALHVISALAPVVTDGIQAMGGVGYMKDFG
FT                   QEKRFRDAGHIQTLLGYLPMKKLNFIRQLL"
     MYASDNKELS LLDKSSAEFA KKILAPGREE NDHYPFGPFF DPVVQKAFDL DFFHILLPED        60
     LGGVGQGIEA LCIVLANICR EDSSLGGIMF TNAFAQNLLL AAGCTGELKD LAAGAKKPSD       120
     FLIACPVLCN PVQQPLRLSA RKEGDGYVLS GTAEYVVLGG MANHALLPAT LADGHAWFLV       180
     NLPDGAISVS DPVVSHGMHA CPATDMTLKD AAARLVGAEE EGPAYFKKVA DTMQLAAAAM       240
     AAGVMRGSLE EALAYCRERR QGGRKIKDWS ELQMLLSSMA VQVHVAEMLV SRACRALSED       300
     AKNWRLSVQA AALHVISALA PVVTDGIQAM GGVGYMKDFG QEKRFRDAGH IQTLLGYLPM       360
     KKLNFIRQLL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page