(data stored in ACNUC7421 zone)

EMBL: CP000859.PE205

CP000859.PE205       Location/Qualifiers
FT   CDS             227044..228987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0205"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dps:DP0495 similar to
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66015"
FT                   /db_xref="GOA:A8ZRZ7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ7"
FT                   /protein_id="ABW66015.1"
FT                   /translation="MALGFITKSYRNRVMALTLPVVVGAVVLVTILAYIFILSNMVNFQ
FT                   RENMETALVGMADGLDTRISEARNAISVLSSRPVHRSDGAAVLELAHAAAPTFFALFLS
FT                   DPGGGLAMAVGEAIPEQVVLPPFETFDMAPGPDGRRSVFVGSVERIPPSMTPVFLVAAP
FT                   VRLVDPSGGEADGVVGGYVDINRLFDSCVASFVPLRTSHVFLADAAGKTLARSGEDVAT
FT                   AVFLAKKTGVKESESLFHKNAAGTRYLSVVRPCLDGWWVVGLSVPLKALFTDLPRLIFY
FT                   SVLLGLATIFLVSLMAWVITGMMVKTINRLTDNLKNIVEGKGDLTQRLTVKGEDEIAGL
FT                   AMWFNRFVEKLGRMITTITKKATRVGEAARALQEFSGEMTHTAGSLKDLSKIVVASTDD
FT                   VNINMASVATTMEQYSHNLDTMASATEQMTATIDQIAQSSGVSMKRTNQAVSYTQTVHE
FT                   SVKDLGDAMEAIGGITDAIARISGQTNLLALNATIEAARAGEQGKGFAVVAGEIKTLAG
FT                   ETDTATKSIHDRVCGIQTSSRSTIDSIDKIADIIRAIDEVVSNTATALEQQSTSTREIA
FT                   ANIMQASEGIQDVHRRISQSTAGLSGMAREIKTLDDRSKIIFQKSGDIDRRAAELAAIA
FT                   EELTTMVSQYKV"
     MALGFITKSY RNRVMALTLP VVVGAVVLVT ILAYIFILSN MVNFQRENME TALVGMADGL        60
     DTRISEARNA ISVLSSRPVH RSDGAAVLEL AHAAAPTFFA LFLSDPGGGL AMAVGEAIPE       120
     QVVLPPFETF DMAPGPDGRR SVFVGSVERI PPSMTPVFLV AAPVRLVDPS GGEADGVVGG       180
     YVDINRLFDS CVASFVPLRT SHVFLADAAG KTLARSGEDV ATAVFLAKKT GVKESESLFH       240
     KNAAGTRYLS VVRPCLDGWW VVGLSVPLKA LFTDLPRLIF YSVLLGLATI FLVSLMAWVI       300
     TGMMVKTINR LTDNLKNIVE GKGDLTQRLT VKGEDEIAGL AMWFNRFVEK LGRMITTITK       360
     KATRVGEAAR ALQEFSGEMT HTAGSLKDLS KIVVASTDDV NINMASVATT MEQYSHNLDT       420
     MASATEQMTA TIDQIAQSSG VSMKRTNQAV SYTQTVHESV KDLGDAMEAI GGITDAIARI       480
     SGQTNLLALN ATIEAARAGE QGKGFAVVAG EIKTLAGETD TATKSIHDRV CGIQTSSRST       540
     IDSIDKIADI IRAIDEVVSN TATALEQQST STREIAANIM QASEGIQDVH RRISQSTAGL       600
     SGMAREIKTL DDRSKIIFQK SGDIDRRAAE LAAIAEELTT MVSQYKV                     647
//

If you have problems or comments...

PBIL Back to PBIL home page