(data stored in ACNUC7421 zone)

EMBL: CP000859.PE208

CP000859.PE208       Location/Qualifiers
FT   CDS             230312..231187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0208"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: pth:PTH_0841
FT                   ABC-type molybdate transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66018"
FT                   /db_xref="GOA:A8ZS00"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS00"
FT                   /protein_id="ABW66018.1"
FT                   /translation="MRKTVFFLLVGLGLTLFGGGQATVKAESDSITVFCGSANKPAMEE
FT                   IAAKFKQEKNINVNMIFGGSGTLLSQIELSKKGEIYLPGSPDYIIIAERKKLIVENSAR
FT                   IVAYLVPAIITPAGNPANIHSLKDLARPGVRVGIGNPETVCLGLYGIELLEKNSLLAPV
FT                   LKNVVTFGGSCSKTANLAAMNQVDAILGWRVFHYWNPDRMAFVPIDPDQIPRLSHIPIS
FT                   IPIYTKDIKLSEAFIEFVLSPVGREAYEKYGYLASLDKAQVFAPQAPVGGEYTLPAAYF
FT                   DIMKDLRQQK"
     MRKTVFFLLV GLGLTLFGGG QATVKAESDS ITVFCGSANK PAMEEIAAKF KQEKNINVNM        60
     IFGGSGTLLS QIELSKKGEI YLPGSPDYII IAERKKLIVE NSARIVAYLV PAIITPAGNP       120
     ANIHSLKDLA RPGVRVGIGN PETVCLGLYG IELLEKNSLL APVLKNVVTF GGSCSKTANL       180
     AAMNQVDAIL GWRVFHYWNP DRMAFVPIDP DQIPRLSHIP ISIPIYTKDI KLSEAFIEFV       240
     LSPVGREAYE KYGYLASLDK AQVFAPQAPV GGEYTLPAAY FDIMKDLRQQ K                291
//

If you have problems or comments...

PBIL Back to PBIL home page