(data stored in ACNUC7421 zone)

EMBL: CP000859.PE212

CP000859.PE212       Location/Qualifiers
FT   CDS             233500..234420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0212"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: smr:Smar_0071 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66022"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS04"
FT                   /protein_id="ABW66022.1"
FT                   /translation="MAVEFMDHAAAAFVAREKGWFTEAGLDVTAYESYATGMALAAALA
FT                   RGDIDAAFICLVPAVNSRFNAGVPVKIVAGTHKHGYGVVVNKKKIKTARDLERPDICVG
FT                   CIRQGGAVDVMLNKAVDVFHLDREAVLPKIRRMPPEKQLLALQTGQLDAVVLPEQWATM
FT                   AEAGDFEMLFTSRDVWPNMQGSVLVVKEDLIDKRPAVVRQLIAVLEQSTAWMNSHPREA
FT                   AEIVSRQLQTMGGGDGPDLGAGTRTVITPAVVERSMTRMDFTTAINPAEVQRAIDFMAR
FT                   LGYLKKAAPAAEILDLRFLEAGGGE"
     MAVEFMDHAA AAFVAREKGW FTEAGLDVTA YESYATGMAL AAALARGDID AAFICLVPAV        60
     NSRFNAGVPV KIVAGTHKHG YGVVVNKKKI KTARDLERPD ICVGCIRQGG AVDVMLNKAV       120
     DVFHLDREAV LPKIRRMPPE KQLLALQTGQ LDAVVLPEQW ATMAEAGDFE MLFTSRDVWP       180
     NMQGSVLVVK EDLIDKRPAV VRQLIAVLEQ STAWMNSHPR EAAEIVSRQL QTMGGGDGPD       240
     LGAGTRTVIT PAVVERSMTR MDFTTAINPA EVQRAIDFMA RLGYLKKAAP AAEILDLRFL       300
     EAGGGE                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page