(data stored in ACNUC7421 zone)

EMBL: CP000859.PE215

CP000859.PE215       Location/Qualifiers
FT   CDS             236378..237106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66025"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS07"
FT                   /protein_id="ABW66025.1"
FT                   /translation="MSTKLYDQIKERFASICDQYDLMDQDVTVKARTLSTEEAIGDPEA
FT                   DDFPLQQGRERLMQADFSGSLGQAFTDRFGDFKGPLREILAMPLENNYRRAIFVATINA
FT                   VMRHLGLADKTIHCRDKGPADCAAALAAFLAEEYGDIKILQVGFQPAMVEALAKRFDYR
FT                   IVDMDPDNIGTEKRGARIEGPDATADAIKWADLLLVTGTTVVNGTIEQFLTDTPVLFYG
FT                   TTIAGAAELMGWPRFCACGT"
     MSTKLYDQIK ERFASICDQY DLMDQDVTVK ARTLSTEEAI GDPEADDFPL QQGRERLMQA        60
     DFSGSLGQAF TDRFGDFKGP LREILAMPLE NNYRRAIFVA TINAVMRHLG LADKTIHCRD       120
     KGPADCAAAL AAFLAEEYGD IKILQVGFQP AMVEALAKRF DYRIVDMDPD NIGTEKRGAR       180
     IEGPDATADA IKWADLLLVT GTTVVNGTIE QFLTDTPVLF YGTTIAGAAE LMGWPRFCAC       240
     GT                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page