(data stored in ACNUC7421 zone)

EMBL: CP000859.PE218

CP000859.PE218       Location/Qualifiers
FT   CDS             238924..239370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66028"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS10"
FT                   /protein_id="ABW66028.1"
FT                   /translation="MKKALSYRLFRLGAIPKKLRPELESEGIVVADEGMAGRFVAKNVK
FT                   GPGRRYRGRVELFSGCLAVTQKRVACFTYGKRQIHIAADDPKLSDLFVDVPAPDTLLIS
FT                   FEAADFRDDWRGVLAFRFKTQKARRFFDVLTALGAGRGRPASGA"
     MKKALSYRLF RLGAIPKKLR PELESEGIVV ADEGMAGRFV AKNVKGPGRR YRGRVELFSG        60
     CLAVTQKRVA CFTYGKRQIH IAADDPKLSD LFVDVPAPDT LLISFEAADF RDDWRGVLAF       120
     RFKTQKARRF FDVLTALGAG RGRPASGA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page