(data stored in ACNUC7421 zone)

EMBL: CP000859.PE223

CP000859.PE223       Location/Qualifiers
FT   CDS             247351..247746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0223"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_01292 response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66033"
FT                   /db_xref="GOA:A8ZS15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS15"
FT                   /protein_id="ABW66033.1"
FT                   /translation="MIDKKILVIDDEGAQRDVMERFIPKLGYAVRVADSAETALAVLKE
FT                   EAFPLVITDLNMPGMDGLELCRRIKQLDAGIIIYALSGYIASFDEAKLDACGFDGYLSK
FT                   PANARVLHQAIEGAFEKIFRRAREEQE"
     MIDKKILVID DEGAQRDVME RFIPKLGYAV RVADSAETAL AVLKEEAFPL VITDLNMPGM        60
     DGLELCRRIK QLDAGIIIYA LSGYIASFDE AKLDACGFDG YLSKPANARV LHQAIEGAFE       120
     KIFRRAREEQ E                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page