(data stored in ACNUC7421 zone)

EMBL: CP000859.PE226

CP000859.PE226       Location/Qualifiers
FT   CDS             complement(251032..251592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0226"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   rrs:RoseRS_2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66036"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS18"
FT                   /protein_id="ABW66036.1"
FT                   /translation="MDIPAGISVKELLLDFSPNLAKKTIAESGAATELAGTEFTMVVEV
FT                   SGDKFAYVVKDGTEFDVKEGDLDNPLVRISITAEDLQKMIETNSLDMLLGIQSDLNKRK
FT                   YNTLQTLKGSFMAQLANDDGSAVSIKTVFNGADTPAATFKMKTADSIALVKKETNPVNL
FT                   FMSGGMQIEGDMAFAMQTQPLFT"
     MDIPAGISVK ELLLDFSPNL AKKTIAESGA ATELAGTEFT MVVEVSGDKF AYVVKDGTEF        60
     DVKEGDLDNP LVRISITAED LQKMIETNSL DMLLGIQSDL NKRKYNTLQT LKGSFMAQLA       120
     NDDGSAVSIK TVFNGADTPA ATFKMKTADS IALVKKETNP VNLFMSGGMQ IEGDMAFAMQ       180
     TQPLFT                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page