(data stored in ACNUC7421 zone)

EMBL: CP000859.PE227

CP000859.PE227       Location/Qualifiers
FT   CDS             251659..251907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66037"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS19"
FT                   /protein_id="ABW66037.1"
FT                   /translation="MFSVNKNLVQTRHTRSEGGLFQNVVFSIGPPFVSGYRQPVKKGRL
FT                   TMFSVWSKETDMSVLLLTTMHVKNKKRVLLFYKKGVA"
     MFSVNKNLVQ TRHTRSEGGL FQNVVFSIGP PFVSGYRQPV KKGRLTMFSV WSKETDMSVL        60
     LLTTMHVKNK KRVLLFYKKG VA                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page