(data stored in ACNUC7421 zone)

EMBL: CP000859.PE228

CP000859.PE228       Location/Qualifiers
FT   CDS             251955..252572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0228"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aae:aq_281
FT                   transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66038"
FT                   /db_xref="GOA:A8ZS20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS20"
FT                   /protein_id="ABW66038.1"
FT                   /translation="MKAEKRKDLILACSKKLFAKQGFYRTQISDIIDEARIARGTIYQY
FT                   FKNKEDIFVSLLEGAYAQWEQAVSQAVAAIDLKTIKPVDYFRLRIQTTLEFLLADPDIC
FT                   SIVLSMGFGLPEDLEKATRKLESKIRDIAVNDFMLGIHNNHVRKNINIDHAAEMIAGAA
FT                   FRSAYYMQKKAKTGDRADIDTMTDEIVNLLAPGIFLPESLKL"
     MKAEKRKDLI LACSKKLFAK QGFYRTQISD IIDEARIARG TIYQYFKNKE DIFVSLLEGA        60
     YAQWEQAVSQ AVAAIDLKTI KPVDYFRLRI QTTLEFLLAD PDICSIVLSM GFGLPEDLEK       120
     ATRKLESKIR DIAVNDFMLG IHNNHVRKNI NIDHAAEMIA GAAFRSAYYM QKKAKTGDRA       180
     DIDTMTDEIV NLLAPGIFLP ESLKL                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page