(data stored in ACNUC7421 zone)

EMBL: CP000859.PE229

CP000859.PE229       Location/Qualifiers
FT   CDS             complement(252624..253778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0229"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   dde:Dde_3621 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66039"
FT                   /db_xref="GOA:A8ZS21"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS21"
FT                   /protein_id="ABW66039.1"
FT                   /translation="MILHVDMDAFFASVEQLDHPEWRGRAVVVGRSSGRGVVAAASYEA
FT                   RVFGVHSAMPMSRALKLCPDAIVAPPRMERYKEVSARVMEILDAVSPLVEQVSIDEAYL
FT                   DISGCERLHGTPETIGKNIKKQVFDTLGITCSVGVAPIKFLAKIASDMNKPDGLMVILP
FT                   EAADRFIETLPVHKVPGVGSVTKKQLALMGIETLGDVVRLPDGVLSKKLGKFGRRLKEL
FT                   SRGIDDSRVVPWHPAKSVSEETTLSRDTAEKQELRHHLLRQAGDVCRHLQKLNARARVV
FT                   FIKIKYADFSQTTRQTTLDAPVQSSDTIYRQASALLEKQTLAQKVRLIGVGVTELVVTS
FT                   GGVQMELFDGEARRDSRWEQVDRSVSAISEKFGKTMVKRGSLDE"
     MILHVDMDAF FASVEQLDHP EWRGRAVVVG RSSGRGVVAA ASYEARVFGV HSAMPMSRAL        60
     KLCPDAIVAP PRMERYKEVS ARVMEILDAV SPLVEQVSID EAYLDISGCE RLHGTPETIG       120
     KNIKKQVFDT LGITCSVGVA PIKFLAKIAS DMNKPDGLMV ILPEAADRFI ETLPVHKVPG       180
     VGSVTKKQLA LMGIETLGDV VRLPDGVLSK KLGKFGRRLK ELSRGIDDSR VVPWHPAKSV       240
     SEETTLSRDT AEKQELRHHL LRQAGDVCRH LQKLNARARV VFIKIKYADF SQTTRQTTLD       300
     APVQSSDTIY RQASALLEKQ TLAQKVRLIG VGVTELVVTS GGVQMELFDG EARRDSRWEQ       360
     VDRSVSAISE KFGKTMVKRG SLDE                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page