(data stored in ACNUC7421 zone)

EMBL: CP000859.PE230

CP000859.PE230       Location/Qualifiers
FT   CDS             complement(253885..254403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66040"
FT                   /db_xref="GOA:A8ZS22"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS22"
FT                   /protein_id="ABW66040.1"
FT                   /translation="MHDNRLQTALARLCNAWEARGLFSRHRLITVGKQMAQWRQDKNIP
FT                   GLWPRPPVLATATLDDGIGMGLDLIELYAGVAGMRIERWGLLMEPDALVEKCKTGCPDL
FT                   LGLTVLREDAMDLLDKGIAPRMPGATTILAGGPVFRMLPLSEQKEKPYVILPDLSAFVR
FT                   YVLGLNRIC"
     MHDNRLQTAL ARLCNAWEAR GLFSRHRLIT VGKQMAQWRQ DKNIPGLWPR PPVLATATLD        60
     DGIGMGLDLI ELYAGVAGMR IERWGLLMEP DALVEKCKTG CPDLLGLTVL REDAMDLLDK       120
     GIAPRMPGAT TILAGGPVFR MLPLSEQKEK PYVILPDLSA FVRYVLGLNR IC               172
//

If you have problems or comments...

PBIL Back to PBIL home page