(data stored in ACNUC7421 zone)

EMBL: CP000859.PE231

CP000859.PE231       Location/Qualifiers
FT   CDS             complement(254396..255181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0231"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   gsu:GSU0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66041"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS23"
FT                   /protein_id="ABW66041.1"
FT                   /translation="MCLILIANRYRADYPFILAANRDEFYDRPTAVLDFWEDAPRVLAG
FT                   RDKKAGGTWLGVTTTGRFAAVTNFRDPRLANPAAPSRGALVSDFLSGTTAPDQYLLDLQ
FT                   QENRPYSGFNLVAGTLDDGLFYYSNREQQVRRISPGLHGLSNHLLDTPWPKVETGRNRL
FT                   KGLLSKGKAFSPDDLLEILHDTTMPPDNRLPDTGVGIAWERVLSPMFIRSPDYGTRSSS
FT                   VILIDGEGRGLFVERTFEPGAGDRLKTQDKRISFQVGHA"
     MCLILIANRY RADYPFILAA NRDEFYDRPT AVLDFWEDAP RVLAGRDKKA GGTWLGVTTT        60
     GRFAAVTNFR DPRLANPAAP SRGALVSDFL SGTTAPDQYL LDLQQENRPY SGFNLVAGTL       120
     DDGLFYYSNR EQQVRRISPG LHGLSNHLLD TPWPKVETGR NRLKGLLSKG KAFSPDDLLE       180
     ILHDTTMPPD NRLPDTGVGI AWERVLSPMF IRSPDYGTRS SSVILIDGEG RGLFVERTFE       240
     PGAGDRLKTQ DKRISFQVGH A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page