(data stored in ACNUC7421 zone)

EMBL: CP000859.PE233

CP000859.PE233       Location/Qualifiers
FT   CDS             256865..257626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66043"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS25"
FT                   /protein_id="ABW66043.1"
FT                   /translation="MIIGLDKFAAHFSGYRDRYLLIGGAAVWLILEEAGIEPRATRDLD
FT                   IVLCLEALDPDFGAVFWDFIKAGGYKIQEKSTGKKNFYRFVKPSQPDYPVMLELFARRP
FT                   DALTLHDDSHLTPIPTSEEASSLSAILLDDNYYDFLHRHKRAIGGISFVSEYGLIPLKA
FT                   RAWLDLTQRKAAGENIDSRDIKKHRNDVLRLYQILSPEIKIDAPEAMRRDLDTFLRQTQ
FT                   PALSQEILKSLGVRDVNVVDVIQTIRIVYGI"
     MIIGLDKFAA HFSGYRDRYL LIGGAAVWLI LEEAGIEPRA TRDLDIVLCL EALDPDFGAV        60
     FWDFIKAGGY KIQEKSTGKK NFYRFVKPSQ PDYPVMLELF ARRPDALTLH DDSHLTPIPT       120
     SEEASSLSAI LLDDNYYDFL HRHKRAIGGI SFVSEYGLIP LKARAWLDLT QRKAAGENID       180
     SRDIKKHRND VLRLYQILSP EIKIDAPEAM RRDLDTFLRQ TQPALSQEIL KSLGVRDVNV       240
     VDVIQTIRIV YGI                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page