(data stored in ACNUC7421 zone)

EMBL: CP000859.PE236

CP000859.PE236       Location/Qualifiers
FT   CDS             259717..260922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0236"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   sfu:Sfum_0928 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66046"
FT                   /db_xref="GOA:A8ZS28"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS28"
FT                   /protein_id="ABW66046.1"
FT                   /translation="MIHRFLERSIIHINVAHFAVTVEQTLDARLRDRPVLIAPAGAART
FT                   PVYDMSQEAFASGIRKGMPVAGALKACRDCKVVPLYPARYERAMQTIAKYAGAYTPVVE
FT                   QGSGDGHLFLDVTGTSRLFGPPPDIAWRLERQIKKDFGLAPAWSVAANKLVAKVATRLV
FT                   KPVGEYIVCPGDEAPFLEPLPLGILPGVERSDLDAFAMYHIGRVNQLRPWSLAQLQVAF
FT                   DTRAQFLFDTIRGIDLSAVTSGREKEPTVAMEHEFSEDTNQRDQMEQVLYGLVEKGGRA
FT                   LRARQRFARIAGVVVDYSDGRRCARQVSIAPPTANDPALFEAARRALSLAVVRRVRVRY
FT                   IRLVLRRLLFPPVQLDLFDHDRQERQTRLLTAMDNIRSKFGDSAIYPGRMEAPGLQQLF
FT                   YA"
     MIHRFLERSI IHINVAHFAV TVEQTLDARL RDRPVLIAPA GAARTPVYDM SQEAFASGIR        60
     KGMPVAGALK ACRDCKVVPL YPARYERAMQ TIAKYAGAYT PVVEQGSGDG HLFLDVTGTS       120
     RLFGPPPDIA WRLERQIKKD FGLAPAWSVA ANKLVAKVAT RLVKPVGEYI VCPGDEAPFL       180
     EPLPLGILPG VERSDLDAFA MYHIGRVNQL RPWSLAQLQV AFDTRAQFLF DTIRGIDLSA       240
     VTSGREKEPT VAMEHEFSED TNQRDQMEQV LYGLVEKGGR ALRARQRFAR IAGVVVDYSD       300
     GRRCARQVSI APPTANDPAL FEAARRALSL AVVRRVRVRY IRLVLRRLLF PPVQLDLFDH       360
     DRQERQTRLL TAMDNIRSKF GDSAIYPGRM EAPGLQQLFY A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page